McDonnell Genome Institute

Washington University

Transcript

lnc-VSX1-1:13

Chromosome

chr20

Gene Name

lnc-VSX1-1

Start

25139464

CPC Label

noncoding

End

25148772

Cancer

OV

Strand

-

Peptide

TLGMNLETSKPPDEK

Modified Peptide

n[145]TLGMNLETSKPPDEK

Peptide Length

15

ORF Length

42

Open Reading Frame (ORF)

LKSSLTIGWSLLSVIYPFRTLGMNLETSKPPDEKYVSTHREN

Conservation Score

0.97

PhyloCSF Frame 1

-5.324

No. of Spectra

1

CPC Coding Probability

0.0569687

PhyloCSF Frame 2 

-4.107

CNTI Index

noncoding

Max Probability

0.427

PhyloCSF Frame 3

-4.336

CNTI Score

-0.366319607