McDonnell Genome Institute

Washington University

Transcript

lnc-VSX1-1:12

Chromosome

chr20

Gene Name

lnc-VSX1-1

Start

25139464

CPC Label

noncoding

End

25148772

Cancer

HCC

Strand

-

Peptide

GTELLPR

Modified Peptide

n[230]GTELLPR

Peptide Length

7

ORF Length

73

Open Reading Frame (ORF)

LLEMRGHSTILRAKQRRGTELLPRDVWPQKVLSRRVMKGRRFPRILEPEDAARVRDSRRFKTRVTAAIFLESL

Conservation Score

0.049

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.0569687

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-4.768

CNTI Score

-0.36438265