McDonnell Genome Institute

Washington University

Transcript

lnc-VSX1-1:10

Chromosome

chr20

Gene Name

lnc-VSX1-1

Start

25143357

CPC Label

noncoding

End

25149422

Cancer

LUAD

Strand

-

Peptide

LLLLSQVAIK

Modified Peptide

n[43]LLLLSQVAIK

Peptide Length

10

ORF Length

73

Open Reading Frame (ORF)

LLLLSQVAIKNSWFSKRLPRFEKRWLMMTTATALSTENSTGLGSAHRTASISGCPDSRRFKTRVTAAIFLESL

Conservation Score

0.193

PhyloCSF Frame 1

-4.121

No. of Spectra

1

CPC Coding Probability

0.0268376

PhyloCSF Frame 2 

-4.886

CNTI Index

noncoding

Max Probability

0.0531

PhyloCSF Frame 3

-4.768

CNTI Score

-0.385549694