McDonnell Genome Institute

Washington University

Transcript

lnc-VSTM5-3:1

Chromosome

chr11

Gene Name

lnc-VSTM5-3

Start

94026968

CPC Label

noncoding

End

94028659

Cancer

OV

Strand

-

Peptide

MRLRQMSLGK

Modified Peptide

n[145]MRLRQM[147]SLGK

Peptide Length

10

ORF Length

43

Open Reading Frame (ORF)

LSLRRNVLHQGEKKMRLRQMSLGKRKGGDGDCTFSLVKLHPPY

Conservation Score

0.454

PhyloCSF Frame 1

-4.904

No. of Spectra

7

CPC Coding Probability

0.0412237

PhyloCSF Frame 2 

-2.068

CNTI Index

noncoding

Max Probability

0.7049

PhyloCSF Frame 3

-3.501

CNTI Score

-0.342652157