McDonnell Genome Institute

Washington University

Transcript

lnc-VSTM2B-9:23

Chromosome

chr19

Gene Name

lnc-VSTM2B-9

Start

27936461

CPC Label

noncoding

End

27958537

Cancer

OV

Strand

+

Peptide

LEPNPSDDPRASTVFLQKSQTDVQEK

Modified Peptide

n[145]LEPNPSDDPRASTVFLQKSQTDVQEK

Peptide Length

26

ORF Length

33

Open Reading Frame (ORF)

LEPNPSDDPRASTVFLQKSQTDVQEKRKSNDMN

Conservation Score

1

PhyloCSF Frame 1

3.315

No. of Spectra

7

CPC Coding Probability

0.0276746

PhyloCSF Frame 2 

7.66

CNTI Index

noncoding

Max Probability

0.4836

PhyloCSF Frame 3

-4.828

CNTI Score

-0.297579676