McDonnell Genome Institute

Washington University

Transcript

lnc-VSTM2B-14:1

Chromosome

chr19

Gene Name

lnc-VSTM2B-14

Start

28606687

CPC Label

coding

End

28615229

Cancer

EOGC

Strand

+

Peptide

AELIALIR

Modified Peptide

n[145]AELIALIR

Peptide Length

8

ORF Length

182

Open Reading Frame (ORF)

MWILRVLLGRHLPQWNASSEWCMAGPHGGSTQGLNTGKELARGVRTSGIWESAAWDHKESKSSATCWSLRPEGRPDFRDHPWMSLDWELYVDGSNFVNSQGERCVGYAVVTLDAVIEAKSLPQGTSAQKAELIALIRASELSEGKTVNIYTDSQYAFLTLQVHGALYKEKGLLNSGGKDVKY

Conservation Score

0.652

PhyloCSF Frame 1

0

No. of Spectra

30

CPC Coding Probability

0.927931

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

0

CNTI Score

-0.267613013