McDonnell Genome Institute

Washington University

Transcript

lnc-VSIG4-2:1

Chromosome

chrX

Gene Name

lnc-VSIG4-2

Start

65956288

CPC Label

coding

End

65957196

Cancer

CCRC

Strand

-

Peptide

SDLYSSGRDQVGR

Modified Peptide

n[230]SDLYSSGRDQVGR

Peptide Length

13

ORF Length

137

Open Reading Frame (ORF)

LHLQDQFAVAVEWEEELLYHVEEIVTEVHLEGNRCPLVESSTYTRAPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDQVGRQERGLPPSMERGYPPPRDSYSSSSRGTPRGGGRGGSRSDRGGGRSRY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.953715

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8017

PhyloCSF Frame 3

0

CNTI Score

-0.299071628