McDonnell Genome Institute

Washington University

Transcript

lnc-VSIG10L2-1:1

Chromosome

chr11

Gene Name

lnc-VSIG10L2-1

Start

125957899

CPC Label

noncoding

End

125958652

Cancer

OV

Strand

+

Peptide

QSSARGGQRAASLAAELEPR

Modified Peptide

n[145]QSSARGGQRAASLAAELEPR

Peptide Length

20

ORF Length

104

Open Reading Frame (ORF)

LSTVKIKFPGGGGRQGASRGEMWTSGRRSHKQSSARGGQRAASLAAELEPRRNSTAGIDHSIRNGTGSIQRVNHNAFGKQYGKMGGAQIMAPDKLGSDSGPMAH

Conservation Score

0.92

PhyloCSF Frame 1

-3.476

No. of Spectra

1

CPC Coding Probability

0.107803

PhyloCSF Frame 2 

-3.567

CNTI Index

noncoding

Max Probability

0.1323

PhyloCSF Frame 3

-3.155

CNTI Score

-0.381637412