McDonnell Genome Institute

Washington University

Transcript

lnc-VRK3-1:1

Chromosome

chr19

Gene Name

lnc-VRK3-1

Start

50041091

CPC Label

noncoding

End

50042784

Cancer

OV

Strand

-

Peptide

GPSPSTHQGLLLLGFLLPEAPDLHCHLGGR

Modified Peptide

n[145]GPSPSTHQGLLLLGFLLPEAPDLHCHLGGR

Peptide Length

30

ORF Length

84

Open Reading Frame (ORF)

LWESWLQPQDGGLEDRRYTRGPSPSTHQGLLLLGFLLPEAPDLHCHLGGRSGWVLGGLQGEKSIVTQPGHGGPSRHSVRTSWLS

Conservation Score

1

PhyloCSF Frame 1

-2.076

No. of Spectra

1

CPC Coding Probability

0.0468598

PhyloCSF Frame 2 

-3.692

CNTI Index

noncoding

Max Probability

0.1365

PhyloCSF Frame 3

-3.096

CNTI Score

-0.35012091