McDonnell Genome Institute

Washington University

Transcript

lnc-VPS8-3:1

Chromosome

chr3

Gene Name

lnc-VPS8-3

Start

184741936

CPC Label

noncoding

End

184742462

Cancer

EOGC

Strand

+

Peptide

CLCTFISPSVK

Modified Peptide

n[145]CLCTFISPSVK

Peptide Length

11

ORF Length

36

Open Reading Frame (ORF)

MTECAPKCLCTFISPSVKCGKKSCKTMCFQLPEIKS

Conservation Score

0.03

PhyloCSF Frame 1

-5.775

No. of Spectra

2

CPC Coding Probability

0.012408

PhyloCSF Frame 2 

-5.958

CNTI Index

noncoding

Max Probability

0.2643

PhyloCSF Frame 3

-4.132

CNTI Score

-0.41200204