McDonnell Genome Institute

Washington University

Transcript

lnc-VPS54-5:1

Chromosome

chr2

Gene Name

lnc-VPS54-5

Start

63642454

CPC Label

noncoding

End

63643788

Cancer

BRCA-Luminal A

Strand

-

Peptide

GHSAVHHITSEEAK

Modified Peptide

n[145]GHSAVHHITSEEAK

Peptide Length

14

ORF Length

96

Open Reading Frame (ORF)

MDVISIDKTGENVRLIYDTKGHSAVHHITSEEAKYKLCKVRKIFVGTKGIPHLVIHDVHTIHYPDPLIKVSNRFRLVWRLARLLILSSSTLVTCVW

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.098508

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.747

PhyloCSF Frame 3

0

CNTI Score

-0.329447907