McDonnell Genome Institute

Washington University

Transcript

lnc-VPS26C-11:1

Chromosome

chr21

Gene Name

lnc-VPS26C-11

Start

37815445

CPC Label

noncoding

End

37815986

Cancer

PRAD

Strand

-

Peptide

GGPSPQNPTMGAQPCYLPRVTCGTDTDKVW

Modified Peptide

GGPSPQNPTMGAQPCYLPRVTCGTDTDKVW

Peptide Length

30

ORF Length

52

Open Reading Frame (ORF)

LSKAKWTGLDDLPGAPSFQDFRGGPSPQNPTMGAQPCYLPRVTCGTDTDKVW

Conservation Score

0.122

PhyloCSF Frame 1

-4.347

No. of Spectra

4

CPC Coding Probability

0.0352387

PhyloCSF Frame 2 

-4.99

CNTI Index

noncoding

Max Probability

0.5739

PhyloCSF Frame 3

-4.05

CNTI Score

-0.408966239