McDonnell Genome Institute

Washington University

Transcript

lnc-VPS13C-3:1

Chromosome

chr15

Gene Name

lnc-VPS13C-3

Start

62082449

CPC Label

noncoding

End

62083305

Cancer

CCRC

Strand

-

Peptide

DELHVVEAEIMNNEGSPIK

Modified Peptide

n[230]DELHVVEAEIM[147]NNEGSPIK

Peptide Length

19

ORF Length

51

Open Reading Frame (ORF)

MDNDTNERQLSLRTTSSGAGAKDELHVVEAEIMNNEGSPIKVTLATLKTSV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.110157

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7499

PhyloCSF Frame 3

0

CNTI Score

-0.339009206