McDonnell Genome Institute

Washington University

Transcript

lnc-VPS13B-1:2

Chromosome

chr8

Gene Name

lnc-VPS13B-1

Start

98995988

CPC Label

noncoding

End

99003223

Cancer

OV

Strand

+

Peptide

FNTNNLLLMGSQHLLSK

Modified Peptide

n[145]FNTNNLLLM[147]GSQHLLSK

Peptide Length

17

ORF Length

48

Open Reading Frame (ORF)

LRSLFLDIPQRFNTNNLLLMGSQHLLSKLLSSDLGNINYRSLWTKVFC

Conservation Score

0.974

PhyloCSF Frame 1

-3.715

No. of Spectra

1

CPC Coding Probability

0.0396233

PhyloCSF Frame 2 

-3.489

CNTI Index

noncoding

Max Probability

0.2957

PhyloCSF Frame 3

-6.248

CNTI Score

-0.37381794