McDonnell Genome Institute

Washington University

Transcript

lnc-VOPP1-6:1

Chromosome

chr7

Gene Name

lnc-VOPP1-6

Start

55253711

CPC Label

noncoding

End

55254901

Cancer

CCRC

Strand

-

Peptide

EQGSQSESPNLK

Modified Peptide

n[230]EQGSQSESPNLK

Peptide Length

12

ORF Length

93

Open Reading Frame (ORF)

LQAKEQGSQSESPNLKSREANNAVFSLWLKAREHLANYWCKPKSPKAEELGVQCLRAGSIQLGRKMEAGRLSQSSPSTFVCLLLSYLHWQLIR

Conservation Score

0.193

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0119064

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5401

PhyloCSF Frame 3

0

CNTI Score

-0.325903453