McDonnell Genome Institute

Washington University

Transcript

lnc-VN1R4-3:1

Chromosome

chr19

Gene Name

lnc-VN1R4-3

Start

53238596

CPC Label

noncoding

End

53241803

Cancer

OV

Strand

-

Peptide

LVSVEFPVSPK

Modified Peptide

n[145]LVSVEFPVSPK

Peptide Length

11

ORF Length

88

Open Reading Frame (ORF)

LVSVEFPVSPKGSVTTLVRYMLIILLEPAVQGVGVSPGKSILQVLNLISANMLTKLLLIPHYSSHTCSCTFFFSMIFMPLLRELTKLN

Conservation Score

0.043

PhyloCSF Frame 1

-4.078

No. of Spectra

17

CPC Coding Probability

0.034174

PhyloCSF Frame 2 

-3.195

CNTI Index

noncoding

Max Probability

0.6344

PhyloCSF Frame 3

-4.303

CNTI Score

-0.381137665