McDonnell Genome Institute

Washington University

Transcript

lnc-VN1R2-5:10

Chromosome

chr19

Gene Name

lnc-VN1R2-5

Start

53197100

CPC Label

coding

End

53216996

Cancer

EOGC

Strand

+

Peptide

SITSMLGQGKEPWTVESEVK

Modified Peptide

n[145]SITSMLGQGKEPWTVESEVK

Peptide Length

20

ORF Length

143

Open Reading Frame (ORF)

MALSQGRLTFRDVAIEFSQEEWKCLDPAQRALYRDVMLENYRNLVSLGISLSEMSITSMLGQGKEPWTVESEVKITKTSSGWECIKGVNTGKSSNGQRGSCTISIQVTPSELKSSVEQKGFKSCELSMETFLCPHLSLCSSDV

Conservation Score

1

PhyloCSF Frame 1

-3.937

No. of Spectra

1

CPC Coding Probability

0.999926

PhyloCSF Frame 2 

-2.605

CNTI Index

coding

Max Probability

0.0761

PhyloCSF Frame 3

8.486

CNTI Score

0.625289065