McDonnell Genome Institute

Washington University

Transcript

lnc-VN1R1-2:1

Chromosome

chr19

Gene Name

lnc-VN1R1-2

Start

57350847

CPC Label

noncoding

End

57352012

Cancer

OV

Strand

-

Peptide

DAPTHLNPVHQHR

Modified Peptide

n[145]DAPTHLNPVHQHR

Peptide Length

13

ORF Length

111

Open Reading Frame (ORF)

LKCAMRANIPGHTNQAGVRLRDAPTHLNPVHQHRRCHEKRMNSLCPVGSAETPRLHRAGRPRAECSTPSLNLPGVKTLTRLRRLLLGETRTRGRVWRPRFHESRVESRPDL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

68

CPC Coding Probability

0.196744

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9705

PhyloCSF Frame 3

0

CNTI Score

-0.33539878