McDonnell Genome Institute

Washington University

Transcript

lnc-VMO1-2:4

Chromosome

chr17

Gene Name

lnc-VMO1-2

Start

4803441

CPC Label

noncoding

End

4807009

Cancer

GBM

Strand

-

Peptide

LETEVAVR

Modified Peptide

n[230]LETEVAVR

Peptide Length

8

ORF Length

69

Open Reading Frame (ORF)

LETEVAVRRDCTTVIQPGQQSKTPSQKLKKGRVLCLMPVIPALWEAEVAGSRAQEIETILANTVKPHLY

Conservation Score

0.331

PhyloCSF Frame 1

0

No. of Spectra

24

CPC Coding Probability

0.122406

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.295862643