McDonnell Genome Institute

Washington University

Transcript

lnc-VKORC1L1-7:4

Chromosome

chr7

Gene Name

lnc-VKORC1L1-7

Start

65751104

CPC Label

noncoding

End

65763674

Cancer

OV

Strand

+

Peptide

AQLGVQAFADVLLVIPK

Modified Peptide

n[145]AQLGVQAFADVLLVIPK

Peptide Length

17

ORF Length

48

Open Reading Frame (ORF)

LCGSGAGAVEVAMAEALNKYKLSVKGKAQLGVQAFADVLLVIPKVSPW

Conservation Score

1

PhyloCSF Frame 1

-4.768

No. of Spectra

15

CPC Coding Probability

0.0752879

PhyloCSF Frame 2 

10.221

CNTI Index

coding

Max Probability

0.9953

PhyloCSF Frame 3

5.006

CNTI Score

0.654707059