McDonnell Genome Institute

Washington University

Transcript

lnc-VKORC1L1-7:1

Chromosome

chr7

Gene Name

lnc-VKORC1L1-7

Start

65750748

CPC Label

noncoding

End

65754606

Cancer

EOGC

Strand

+

Peptide

VAFFSSSGAVMAAAK

Modified Peptide

n[145]VAFFSSSGAVMAAAK

Peptide Length

15

ORF Length

91

Open Reading Frame (ORF)

LGAPTFPEDPDSASRPRRACSGLSACRVAFFSSSGAVMAAAKTLNPKAKVAGAQAALAFNISGARGLQDVLRTNLGPKGTIKIKFNTQQLP

Conservation Score

1

PhyloCSF Frame 1

8.613

No. of Spectra

7

CPC Coding Probability

0.0787266

PhyloCSF Frame 2 

6.816

CNTI Index

noncoding

Max Probability

0.92

PhyloCSF Frame 3

-3.943

CNTI Score

-0.304308986