McDonnell Genome Institute

Washington University

Transcript

lnc-VIRMA-1:2

Chromosome

chr8

Gene Name

lnc-VIRMA-1

Start

94626966

CPC Label

noncoding

End

94640745

Cancer

CCRC

Strand

-

Peptide

MAFLDYNK

Modified Peptide

n[272]M[147]AFLDYNK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

MAFLDYNKTKILMCFNAMSLKISICMCVYVWHIYMYIYI

Conservation Score

0.917

PhyloCSF Frame 1

-4.473

No. of Spectra

12

CPC Coding Probability

0.448675

PhyloCSF Frame 2 

-5.802

CNTI Index

coding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

0.660818579