McDonnell Genome Institute

Washington University

Transcript

lnc-VIPR1-2:1

Chromosome

chr3

Gene Name

lnc-VIPR1-2

Start

42469639

CPC Label

noncoding

End

42469879

Cancer

OV

Strand

+

Peptide

LEDCGPRPFLLAINGVSR

Modified Peptide

n[145]LEDCGPRPFLLAINGVSR

Peptide Length

18

ORF Length

71

Open Reading Frame (ORF)

LEDCGPRPFLLAINGVSRTKGSTQLFLKLKVFMPEMKQNSIWAKRPTETVAWFMPNSKAIFLLRLLDTESE

Conservation Score

1

PhyloCSF Frame 1

-4.716

No. of Spectra

1

CPC Coding Probability

0.0222331

PhyloCSF Frame 2 

-3.633

CNTI Index

noncoding

Max Probability

0.9495

PhyloCSF Frame 3

-3.799

CNTI Score

-0.42862092