McDonnell Genome Institute

Washington University

Transcript

lnc-VIP-3:1

Chromosome

chr6

Gene Name

lnc-VIP-3

Start

153131473

CPC Label

noncoding

End

153132254

Cancer

OV

Strand

+

Peptide

GSAGTLGFGDARPELR

Modified Peptide

n[145]GSAGTLGFGDARPELR

Peptide Length

16

ORF Length

132

Open Reading Frame (ORF)

LGAAPTVRRGSAGTLGFGDARPELRGRPGVPRASLGDSGSPPGPLQLHSPVARALLSWAAREPCTQEPACQAQQPACSGSRRKHSLRGGSRKCEVKQVLLPEGLYEASFTLLTSSPRKRTFSPKNQCRCSLA

Conservation Score

0.996

PhyloCSF Frame 1

0.728

No. of Spectra

55

CPC Coding Probability

0.0117873

PhyloCSF Frame 2 

-1.62

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

-0.919

CNTI Score

-0.337776691