McDonnell Genome Institute

Washington University

Transcript

lnc-VGLL3-10:1

Chromosome

chr3

Gene Name

lnc-VGLL3-10

Start

84691680

CPC Label

noncoding

End

84692591

Cancer

BRCA-Basal-like

Strand

-

Peptide

LTFLVQNGPR

Modified Peptide

n[145]LTFLVQNGPR

Peptide Length

10

ORF Length

65

Open Reading Frame (ORF)

MLTFLVQNGPREEPMWEINFKFKKQAPTLKSNVREDCSLSFSMKMFTPTQSRCAAYCRSPPSISS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

38

CPC Coding Probability

0.116398

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

-0.411625712