McDonnell Genome Institute

Washington University

Transcript

lnc-VGF-4:1

Chromosome

chr7

Gene Name

lnc-VGF-4

Start

101127189

CPC Label

noncoding

End

101130513

Cancer

CCRC

Strand

-

Peptide

AGAMPLSAPGQR

Modified Peptide

n[230]AGAMPLSAPGQR

Peptide Length

12

ORF Length

34

Open Reading Frame (ORF)

LISSLFHGPMSSLYRCRRAGAMPLSAPGQRGEDM

Conservation Score

1

PhyloCSF Frame 1

-5.303

No. of Spectra

36

CPC Coding Probability

0.18925

PhyloCSF Frame 2 

-4.497

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

10.029

CNTI Score

-0.37452707