McDonnell Genome Institute

Washington University

Transcript

lnc-VCAN-4:1

Chromosome

chr5

Gene Name

lnc-VCAN-4

Start

83201228

CPC Label

noncoding

End

83202141

Cancer

OV

Strand

+

Peptide

EAAEQDIEK

Modified Peptide

n[145]EAAEQDIEK

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

MKYLYEGESQSHHQGGRELNAWLFGLWAKRTKEAAEQDIEK

Conservation Score

1

PhyloCSF Frame 1

-4.357

No. of Spectra

15

CPC Coding Probability

0.048222

PhyloCSF Frame 2 

-3.031

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-5.022

CNTI Score

-0.394933456