McDonnell Genome Institute

Washington University

Transcript

lnc-VAX2-3:1

Chromosome

chr2

Gene Name

lnc-VAX2-3

Start

70871425

CPC Label

noncoding

End

70876622

Cancer

OV

Strand

+

Peptide

LAAARVGEPCQCEISLK

Modified Peptide

n[145]LAAARVGEPCQCEISLK

Peptide Length

17

ORF Length

40

Open Reading Frame (ORF)

LEVAGRTAAALLEAGGHRLAAARVGEPCQCEISLKTGAWY

Conservation Score

0.017

PhyloCSF Frame 1

-4.119

No. of Spectra

1

CPC Coding Probability

0.00449376

PhyloCSF Frame 2 

-4.396

CNTI Index

noncoding

Max Probability

0.5247

PhyloCSF Frame 3

-4.163

CNTI Score

-0.295794896