McDonnell Genome Institute

Washington University

Transcript

lnc-VAV3-11:1

Chromosome

chr1

Gene Name

lnc-VAV3-11

Start

107046539

CPC Label

noncoding

End

107056615

Cancer

OV

Strand

-

Peptide

MVYSHQSLINLK

Modified Peptide

n[145]MVYSHQSLINLK

Peptide Length

12

ORF Length

62

Open Reading Frame (ORF)

MVYSHQSLINLKYLPRNLCLRRICVWLMACRDGGRTIWSGGREPKDFLELNQTEKPQLSKPK

Conservation Score

0.3

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0518038

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.986

PhyloCSF Frame 3

0

CNTI Score

-0.349949833