McDonnell Genome Institute

Washington University

Transcript

lnc-VASH2-3:1

Chromosome

chr1

Gene Name

lnc-VASH2-3

Start

213015914

CPC Label

noncoding

End

213018244

Cancer

OV

Strand

+

Peptide

MYVYGPGAVAHACNPSTLGGQGGR

Modified Peptide

n[145]MYVYGPGAVAHACNPSTLGGQGGR

Peptide Length

24

ORF Length

58

Open Reading Frame (ORF)

MELRYHRILQLMLRKHSHSSHFKMYVYGPGAVAHACNPSTLGGQGGRITRSGDRDHPG

Conservation Score

0.142

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0303362

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9044

PhyloCSF Frame 3

0

CNTI Score

-0.351016493