McDonnell Genome Institute

Washington University

Transcript

lnc-VANGL1-18:1

Chromosome

chr1

Gene Name

lnc-VANGL1-18

Start

115505542

CPC Label

noncoding

End

115537171

Cancer

HCC

Strand

+

Peptide

MIDPLMPCR

Modified Peptide

n[230]MIDPLM[147]PCR

Peptide Length

9

ORF Length

59

Open Reading Frame (ORF)

MIDPLMPCRGYRTNRCLDHGKTNYRRGRRGGLASKGDLVLWMKPHRPQPSERIDGKCLF

Conservation Score

0.777

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.145366

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.317203808