McDonnell Genome Institute

Washington University

Transcript

lnc-UTY-18:1

Chromosome

chrY

Gene Name

lnc-UTY-18

Start

10190376

CPC Label

coding

End

10192298

Cancer

BRCA-Luminal B

Strand

-

Peptide

VHSFPTPQCK

Modified Peptide

n[145]VHSFPTPQCK

Peptide Length

10

ORF Length

157

Open Reading Frame (ORF)

MTVLQEPVQPAIWEALNHYAYLDGVFPAECLYAEVHSEEALFLLATCSYYPGKAYNAYSLFKVHSFPTPQCKYLLAKCCVDLSKLAEGEQILSGGVFHKQKSHDDIVTKFGDSACFPLPLLGHVYCKTDRLVKGSEYYQKSLSLNPFIWYPLNHYVK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.954465

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9864

PhyloCSF Frame 3

0

CNTI Score

-0.380069876