McDonnell Genome Institute

Washington University

Transcript

lnc-UTY-11:1

Chromosome

chrY

Gene Name

lnc-UTY-11

Start

11781051

CPC Label

coding

End

11782527

Cancer

OSCC

Strand

-

Peptide

NKNPNFIPLGALNMVTWYTTHDEK

Modified Peptide

n[145]NKNPNFIPLGALNM[147]VTWYTTHDEK

Peptide Length

24

ORF Length

97

Open Reading Frame (ORF)

LQKPKLKPKQKTKNKNPNFIPLGALNMVTWYTTHDEKFMSPLLWIESSWELMPRQVAVFMEKEERLADFASTTRGCADVACRANHMLVLDSQKHIFF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.668378

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4147

PhyloCSF Frame 3

0

CNTI Score

-0.328869885