McDonnell Genome Institute

Washington University

Transcript

lnc-UTY-10:1

Chromosome

chrY

Gene Name

lnc-UTY-10

Start

12406115

CPC Label

noncoding

End

12421590

Cancer

EOGC

Strand

-

Peptide

TMSGSHSVTQAGVEWYNHSSLQPQTPR

Modified Peptide

n[145]TM[147]SGSHSVTQAGVEWYNHSSLQPQTPR

Peptide Length

27

ORF Length

126

Open Reading Frame (ORF)

LRVRDEDLFPPTAPGRRSAGPRPLRAAPRTMSGSHSVTQAGVEWYNHSSLQPQTPRLKYPPTSASQVAVTTVTDQAFVTLATDDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVSLVAQA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.363163

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9289

PhyloCSF Frame 3

0

CNTI Score

-0.319194359