McDonnell Genome Institute

Washington University

Transcript

lnc-UTP3-1:1

Chromosome

chr4

Gene Name

lnc-UTP3-1

Start

70692620

CPC Label

noncoding

End

70695742

Cancer

EOGC

Strand

+

Peptide

IFQNLLCIFNK

Modified Peptide

n[145]IFQNLLCIFNK

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LGLQARATTPSRIFQNLLCIFNKHLKSTEMCWVLSFVHE

Conservation Score

0.125

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.0506975

PhyloCSF Frame 2 

-4.925

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

-5.151

CNTI Score

-0.359356679