McDonnell Genome Institute

Washington University

Transcript

lnc-UTP23-11:1

Chromosome

chr8

Gene Name

lnc-UTP23-11

Start

115427966

CPC Label

noncoding

End

115476011

Cancer

LUAD

Strand

+

Peptide

MHYTSVSLSK

Modified Peptide

n[230]M[147]HYTSVSLSK

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

MHYTSVSLSKSSYYYFFSMFFHIFRRVGKKKQKAKHP

Conservation Score

0.951

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.167911

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

0

CNTI Score

-0.376924363