McDonnell Genome Institute

Washington University

Transcript

lnc-UTP20-2:1

Chromosome

chr12

Gene Name

lnc-UTP20-2

Start

101066733

CPC Label

noncoding

End

101069232

Cancer

HCC

Strand

+

Peptide

VLMQSFLLELRR

Modified Peptide

VLM[147]QSFLLELRR

Peptide Length

12

ORF Length

39

Open Reading Frame (ORF)

LEYDQDLSVRWKNTKEMFGGFFKSVVKVLMQSFLLELRR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.189917

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7137

PhyloCSF Frame 3

0

CNTI Score

-0.333188259