McDonnell Genome Institute

Washington University

Transcript

lnc-UTP14A-1:1

Chromosome

chrX

Gene Name

lnc-UTP14A-1

Start

129871308

CPC Label

coding

End

129877567

Cancer

OV

Strand

+

Peptide

HNCKNCSK

Modified Peptide

n[145]HNCKNCSK

Peptide Length

8

ORF Length

207

Open Reading Frame (ORF)

LKTLDSHMSKQVSVAVALLSQKAGSQGLSLDTLNKPSYLTSIPSAASSVTPWLTPFTLKLDRTRVLLNIVSQLPSALLPQAWVLCSSRVLSLLWHYTHPRKRKISHQTSEMCVKPKDEAILYKHNCKNCSKVWETGSSLQIYPHMHTGERPFMFSVCGHGFTTKGNLKVYFNQYPQVKANPQLFAKFQNKMVVGNGTPCTPCTCPHR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.941468

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4073

PhyloCSF Frame 3

0

CNTI Score

-0.308696172