McDonnell Genome Institute

Washington University

Transcript

lnc-UTP11-1:5

Chromosome

chr1

Gene Name

lnc-UTP11-1

Start

38047133

CPC Label

noncoding

End

38121056

Cancer

OV

Strand

+

Peptide

GHTGARPSGSCLQSQHFGRPR

Modified Peptide

n[145]GHTGARPSGSCLQSQHFGRPR

Peptide Length

21

ORF Length

57

Open Reading Frame (ORF)

LCNGEKDPTSWRDCEADRKGHTGARPSGSCLQSQHFGRPRQEEFETSLANMVKPCLY

Conservation Score

0.321

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.187637

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6974

PhyloCSF Frame 3

0

CNTI Score

0.676947643