McDonnell Genome Institute

Washington University

Transcript

lnc-USPL1-2:9

Chromosome

chr13

Gene Name

lnc-USPL1-2

Start

30714896

CPC Label

noncoding

End

30716932

Cancer

OV

Strand

+

Peptide

ALTCHMTMAK

Modified Peptide

n[145]ALTCHMTM[147]AK

Peptide Length

10

ORF Length

63

Open Reading Frame (ORF)

LSPLVIQKQLGFPGFGAWQPGFENRALTCHMTMAKFLGLSKLHFLCKKGNNIIPVLLGFVHVR

Conservation Score

0.166

PhyloCSF Frame 1

-2.068

No. of Spectra

2

CPC Coding Probability

0.0239974

PhyloCSF Frame 2 

-5.071

CNTI Index

noncoding

Max Probability

0.8097

PhyloCSF Frame 3

-4.702

CNTI Score

-0.379066241