McDonnell Genome Institute

Washington University

Transcript

lnc-USP9Y-7:1

Chromosome

chrY

Gene Name

lnc-USP9Y-7

Start

12354095

CPC Label

noncoding

End

12387328

Cancer

OV

Strand

+

Peptide

DYATGLISK

Modified Peptide

n[145]DYATGLISK

Peptide Length

9

ORF Length

94

Open Reading Frame (ORF)

LHPKPSCIPHGETFFQVRHGRQQWILGPSVECRLRWLPENETTFARILQHRDYATGLISKILNAIEDNDLRNSTFTYFTSDHGGHLEARDGHRS

Conservation Score

1

PhyloCSF Frame 1

8.608

No. of Spectra

19

CPC Coding Probability

0.442683

PhyloCSF Frame 2 

6.51

CNTI Index

noncoding

Max Probability

0.9474

PhyloCSF Frame 3

7.75

CNTI Score

-0.306169895