McDonnell Genome Institute

Washington University

Transcript

lnc-USP9Y-2:1

Chromosome

chrY

Gene Name

lnc-USP9Y-2

Start

12345076

CPC Label

noncoding

End

12347495

Cancer

CCRC

Strand

+

Peptide

GLPVLWGK

Modified Peptide

n[230]GLPVLWGK

Peptide Length

8

ORF Length

80

Open Reading Frame (ORF)

LCVLNTALIGLLQSTAHPMAIVPAECIPKMIHCMKFMEEQCGTPLCDACVPARGSRCLLWKKGLPVLWGKSSPPRSTFAL

Conservation Score

1

PhyloCSF Frame 1

6.503

No. of Spectra

32

CPC Coding Probability

0.0797108

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9932

PhyloCSF Frame 3

-4.685

CNTI Score

-0.326444812