McDonnell Genome Institute

Washington University

Transcript

lnc-USP9Y-17:1

Chromosome

chrY

Gene Name

lnc-USP9Y-17

Start

11128015

CPC Label

coding

End

11157871

Cancer

OV

Strand

+

Peptide

VSGVEALR

Modified Peptide

n[145]VSGVEALR

Peptide Length

8

ORF Length

182

Open Reading Frame (ORF)

LLLGSLGLSGTEEKGVEGPDQVMRGGRVVGRRRSHLWGSGCPTFCRWCCSLCRASSSSSQRRPKARFTASHWSPRSSEVSRRMQSTSTHRLAESRRSRWARHRLSCVNLVRVSGVEALRGWGQPGEGRGGSANGWGPCRAPIPCLHPMLLEELHGLQCIPCRPTKPSPPSSLPPSSPRPQLP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.455

PhyloCSF Frame 3

0

CNTI Score

-0.283660019