McDonnell Genome Institute

Washington University

Transcript

lnc-USP9Y-15:1

Chromosome

chrY

Gene Name

lnc-USP9Y-15

Start

11314920

CPC Label

noncoding

End

11316187

Cancer

PRAD

Strand

+

Peptide

QAACTTRPPGGVTLLPR

Modified Peptide

QAACTTRPPGGVTLLPR

Peptide Length

17

ORF Length

75

Open Reading Frame (ORF)

LRSIAFQASPLGKSWPERRASRSPRFRSSFRIKGPGTRDRVADGTRRQAACTTRPPGGVTLLPRGSPSPTLARGE

Conservation Score

0.058

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.302661

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6752

PhyloCSF Frame 3

0

CNTI Score

0.726242696