McDonnell Genome Institute

Washington University

Transcript

lnc-USP9Y-13:1

Chromosome

chrY

Gene Name

lnc-USP9Y-13

Start

11332328

CPC Label

coding

End

11333595

Cancer

LUAD

Strand

+

Peptide

VGAGAGVPR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

97

Open Reading Frame (ORF)

LSRHARILPTPPRLLQKGRSPTLRLLRGLRTRAKAGRTRTRSVTACRLLARWDSLGPLKRGHRAKVCLRHPRPRGVRVGAGAGVPRAQGRPGNPKPG

Conservation Score

0.052

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.633999

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9952

PhyloCSF Frame 3

0

CNTI Score

0.757801167