McDonnell Genome Institute

Washington University

Transcript

lnc-USP6NL-8:11

Chromosome

chr10

Gene Name

lnc-USP6NL-8

Start

10435948

CPC Label

noncoding

End

10462285

Cancer

OSCC

Strand

-

Peptide

TLLTAVMLK

Modified Peptide

n[145]TLLTAVM[147]LK

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LQMQEGRKTRTLLTAVMLKKVQPKKPHIFCSPG

Conservation Score

0.018

PhyloCSF Frame 1

-6.41

No. of Spectra

13

CPC Coding Probability

0.00895372

PhyloCSF Frame 2 

-4.474

CNTI Index

noncoding

Max Probability

0.9608

PhyloCSF Frame 3

-5.895

CNTI Score

-0.415389605