McDonnell Genome Institute

Washington University

Transcript

lnc-USP6-4:12

Chromosome

chr17

Gene Name

lnc-USP6-4

Start

5113358

CPC Label

noncoding

End

5115004

Cancer

CCRC

Strand

+

Peptide

KLTEPEFQYVK

Modified Peptide

n[230]KLTEPEFQYVK

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

MKLTEPEFQYVKLQCAIILLNPTEQIESQLLLLHERRQWVL

Conservation Score

0.553

PhyloCSF Frame 1

-3.563

No. of Spectra

1

CPC Coding Probability

0.0152417

PhyloCSF Frame 2 

-3.955

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

-4.784

CNTI Score

-0.42529545