McDonnell Genome Institute

Washington University

Transcript

lnc-USP53-8:19

Chromosome

chr4

Gene Name

lnc-USP53-8

Start

119474615

CPC Label

noncoding

End

119488717

Cancer

PRAD

Strand

+

Peptide

VNSNVNYGLWVIMMCQHR

Modified Peptide

VNSNVNYGLWVIMM[147]CQHR

Peptide Length

18

ORF Length

77

Open Reading Frame (ORF)

MIHIGGSMVIIHLSKLIECATSRVNSNVNYGLWVIMMCQHRYINYNKYTTLVPSVNTGGTDVCRGQWYMGTFCNFGN

Conservation Score

0.28

PhyloCSF Frame 1

-4.839

No. of Spectra

3

CPC Coding Probability

0.0606254

PhyloCSF Frame 2 

-3.765

CNTI Index

noncoding

Max Probability

0.9396

PhyloCSF Frame 3

-4.981

CNTI Score

-0.399435547