McDonnell Genome Institute

Washington University

Transcript

lnc-USP53-6:1

Chromosome

chr4

Gene Name

lnc-USP53-6

Start

120066859

CPC Label

noncoding

End

120070468

Cancer

BRCA-Luminal B

Strand

+

Peptide

VPMSFHIK

Modified Peptide

n[145]VPMSFHIK

Peptide Length

8

ORF Length

46

Open Reading Frame (ORF)

MVPMSFHIKTPSLSKEFYVKTQHFRKGFLEFHDDVLFKLPEATHNC

Conservation Score

0.224

PhyloCSF Frame 1

-3.655

No. of Spectra

4

CPC Coding Probability

0.0809406

PhyloCSF Frame 2 

-4.195

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

-3.437

CNTI Score

-0.365358634