McDonnell Genome Institute

Washington University

Transcript

lnc-USP48-4:1

Chromosome

chr1

Gene Name

lnc-USP48-4

Start

21622922

CPC Label

noncoding

End

21669283

Cancer

BRCA-Luminal B

Strand

-

Peptide

VNLVPSYTPSLYPK

Modified Peptide

n[145]VNLVPSYTPSLYPK

Peptide Length

14

ORF Length

127

Open Reading Frame (ORF)

LGFGASCGAPGLGEETLCTHTCTHTQSPEVNTSANRGHPPSDPHSEEADPSSNSDIATEQPYNFWVDKSFTSRRSVWRSDGQNQHFPQALDLSRVNLVPSYTPSLYPKLFHLLEPASHLYNGDDICT

Conservation Score

1

PhyloCSF Frame 1

-1.517

No. of Spectra

3

CPC Coding Probability

0.00848674

PhyloCSF Frame 2 

-4.024

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-0.732

CNTI Score

-0.333025686